DPCfam | MC193809
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Residues in low-complexity regions (%) | 3.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.91 |
| Average transmembrane regions | 0.3 |
| Dominant Pfam architecture(s) | PF01569 |
| Sequences matching dominant architecture (%) | 97.14 |
| Average overlap percent | 51.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G3LMA9 | 118-181 | 64 | TGVVSLLKSLTHMDCPWDLSRYGGHLPYIGLFEPRPAGMPHAACFPAGHSSAGYAWVALYFVAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HW20-F1 | 101-172 | 98.63 | 96.21 | View in AlphaFoldDB ↗ |