DPCfam | MC193798
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14978 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 87.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P4WT07 | 3-105 | 102 | LALVLLRKRMPNGHIHTGKHRLYPKVTKMDTADMKRRLEIEEQNMLILRYPYLTLDQSWGHAQALGKGKAFCDKMKNFSEKWLPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W551-F1 | 1-106 | 100.00 | 86.86 | View in AlphaFoldDB ↗ |