DPCfam | MC193704
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 178 ± 24 aa |
| Residues in low-complexity regions (%) | 1.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00053 |
| Sequences matching dominant architecture (%) | 91.89 |
| Average overlap percent | 13.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H9F3L2 | 32-216 | 185 | CDEATGQCHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGETPSWTGSGFVRLREGQALEFLVASVPKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P07942-F1 | 522-704 | 100.00 | 85.18 | View in AlphaFoldDB ↗ |