DPCfam | MC193499
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.65 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03838 |
| Sequences matching dominant architecture (%) | 93.68 |
| Average overlap percent | 87.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2IN06 | 6-150 | 145 | ANRGMTFERLIENACDIYQIKKLAIIQKLPTDWKIIRNGAQITGAFPNKKSTVDFMGVLNPGMAIAFEAKETKAKSFPFKNIHEH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C5D324-F1 | 29-180 | 95.30 | 95.30 | View in AlphaFoldDB ↗ |