DPCfam | MC19328
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 60 ± 10 aa |
| Residues in low-complexity regions (%) | 7.01 |
| Residues in coiled-coil regions (%) | 0.61 |
| Predicted disordered residues (%) | 0.66 |
| Average transmembrane regions | 1.39 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4YUR9 | 101-160 | 60 | FSEHAEVYDTGMVIAVIIFLIPAAIFALISTIFGLVNILTVPIETLHGPVGLYIWNLIGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P58418-F1 | 85-156 | 100.00 | 90.92 | View in AlphaFoldDB ↗ |