DPCfam | MC193218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Residues in low-complexity regions (%) | 2.72 |
| Residues in coiled-coil regions (%) | 9.95 |
| Predicted disordered residues (%) | 29.56 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF08397 |
| Sequences matching dominant architecture (%) | 96.69 |
| Average overlap percent | 41.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B4JD47 | 159-251 | 93 | LQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FA94-F1 | 163-263 | 99.02 | 90.13 | View in AlphaFoldDB ↗ |