DPCfam | MC192950
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 191 ± 45 aa |
| Residues in low-complexity regions (%) | 8.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.46 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000441ED9E | 189-391 | 203 | FGPPKSRRRILIAPPMSGVAPSSRKPQPPVPSVVEQVQDLKASPEAQDSISTEESDLLMLGAWIEKRKQLHNLLDNCVNLEEWLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95LL8-F1 | 40-256 | 98.70 | 70.70 | View in AlphaFoldDB ↗ |