DPCfam | MC192596
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Residues in low-complexity regions (%) | 4.37 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 21.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5TG07 | 276-347 | 72 | QEMILQNLRNDPALRFTDHGRSVLRRLATTVMDIKEWEHLLAGAPEHCKGALAKLAHANADSWTSLARSLEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P08076-F1 | 268-335 | 97.14 | 78.30 | View in AlphaFoldDB ↗ |