DPCfam | MC192592
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05954 |
| Sequences matching dominant architecture (%) | 94.12 |
| Average overlap percent | 37.78 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9NM86 | 212-347 | 136 | VELPLRSPSGFSNSEQDSVWALKTRHRVVEQQVSVRAYHPDDSRAYLDGEVDQTRGEPATHGVATTRGVADNTYGDAYHYAEPYR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GRZ3-F1 | 210-321 | 99.12 | 90.34 | View in AlphaFoldDB ↗ |