DPCfam | MC192537
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 310 ± 34 aa |
| Residues in low-complexity regions (%) | 2.91 |
| Residues in coiled-coil regions (%) | 0.9 |
| Predicted disordered residues (%) | 16.54 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF11262 |
| Sequences matching dominant architecture (%) | 92.06 |
| Average overlap percent | 92.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D1W307 | 906-1237 | 332 | DLITPVMTQAPMEDISLRFYVLYWFLSLYDLYVPKDVYGQEIEKLQEIVDQPDIHGDDHIQTVYKKKKEKERAQIIITRLREEMS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K8V3-F1 | 871-1181 | 99.03 | 87.95 | View in AlphaFoldDB ↗ |