DPCfam | MC192453
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 691 |
|---|---|
| Mean domain length (aa) | 191 ± 30 aa |
| Residues in low-complexity regions (%) | 1.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04228 |
| Sequences matching dominant architecture (%) | 75.51 |
| Average overlap percent | 78.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A164C8N1 | 47-186 | 140 | FQPPQVFAIEQGTKVYGGCGEFVRGDEVGGSSYCPATNTIYLVPSQLNYFYKAFGPSSVAYVVAHEFGHAIQNRYGSLEGGAEVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HV81-F1 | 86-292 | 98.38 | 94.70 | View in AlphaFoldDB ↗ |