DPCfam | MC19243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Residues in low-complexity regions (%) | 4.25 |
| Residues in coiled-coil regions (%) | 44.69 |
| Predicted disordered residues (%) | 37.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16566 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 93.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U6JFY8 | 218-361 | 144 | TGELIRQLEALQSAPSANAITRQKISEFPEEVSDPQMVTKMLSEGVDQKTMVERIQTALRQLESYNRSLDEEMVQRHNLNLSLRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7ZUK9-F1 | 186-329 | 98.61 | 88.29 | View in AlphaFoldDB ↗ |