DPCfam | MC192047
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Residues in low-complexity regions (%) | 27.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.07 |
| Average transmembrane regions | 3.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S2HPP6 | 21-124 | 104 | AMSAAGACWAIGTVAMGHEPDAGGATIGLAQVLIVTAAVGLVAWASRAVVARWASRWGRAWLLATAGIGAVSLIGPLTLARDGSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EML0-F1 | 28-136 | 96.49 | 93.74 | View in AlphaFoldDB ↗ |