DPCfam | MC191712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 406 ± 91 aa |
| Residues in low-complexity regions (%) | 5.67 |
| Residues in coiled-coil regions (%) | 0.29 |
| Predicted disordered residues (%) | 38.74 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00439- PF12024 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 76.75 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6JIT1 | 110-445 | 336 | KSPLQKLLDNLQQSLEKKDPQQFFAWPVTDQIAPGYSQIIHQPMDFSTMHQKIEDNSYGTLKDYVDDFKQMCGNAMIYNHPETIY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JTM7-F1 | 133-607 | 99.78 | 73.15 | View in AlphaFoldDB ↗ |