DPCfam | MC19165
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Residues in low-complexity regions (%) | 8.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 71.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16000 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 39.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000775A27E | 64-123 | 60 | EGKKLEHFTKLRPKRNKKQQPTQSAVSPATFQEGEQNGMMGRVDEGVDEFFTKKVTKMDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F6NI44-F1 | 1014-1077 | 96.97 | 35.56 | View in AlphaFoldDB ↗ |