DPCfam | MC19159
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Residues in low-complexity regions (%) | 8.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00068F5A3F | 1-68 | 68 | MAQARALAMICAHAGIAVRDWMLTSWILEDRAGGTLIVETLPEVWEGVARLSGRPVDPLDDAFIARME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O25081-F1 | 1-112 | 98.98 | 79.75 | View in AlphaFoldDB ↗ |