DPCfam | MC191477
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 391 ± 47 aa |
| Residues in low-complexity regions (%) | 5.74 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 25.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J0MBT2 | 418-783 | 366 | EQTGNNNSGKKILVNVGTWPDAAGAPSIFTRVIKSGNGGINTVSGALDWQDSGNSGAQEFYLYNADELLSDYFEVAMVMPRRPEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45938-F1 | 246-356 | 25.88 | 94.00 | View in AlphaFoldDB ↗ |