DPCfam | MC191114
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 635 ± 90 aa |
| Residues in low-complexity regions (%) | 8.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.8 |
| Average transmembrane regions | 0.26 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A162MQ91 | 17-827 | 811 | QKRPRLSYLRSAWTTTDLYYTNSFQSTSSSSSTSSPTTEAEQEQEQENFYDIKLPLIQLHDYEDETAPEQEKDEIILEIFRMITA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JQR5-F1 | 429-502 | 11.99 | 88.06 | View in AlphaFoldDB ↗ |