DPCfam | MC190993
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 389 ± 33 aa |
| Residues in low-complexity regions (%) | 9.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.78 |
| Average transmembrane regions | 6.46 |
| Dominant Pfam architecture(s) | PF00664 |
| Sequences matching dominant architecture (%) | 73.08 |
| Average overlap percent | 6.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0CBV6 | 3-402 | 400 | PDLNTWSVVSGALGLSLVGLFSSPAVLKAFRPKPVQPIRLDDEVPGKKWYQDEDGEAAEESQESYSNLGQRIAITLFSATGLASA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2H624-F1 | 17-423 | 99.49 | 79.91 | View in AlphaFoldDB ↗ |