DPCfam | MC190985
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13368 |
| Sequences matching dominant architecture (%) | 68.12 |
| Average overlap percent | 85.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061RF57 | 728-785 | 58 | LLGENPETGEEVTLRIGPYGPYLQMEAPGGHAAKRTSLPRGTDMSTLTLETALSLLRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0R5D9-F1 | 787-842 | 98.25 | 88.92 | View in AlphaFoldDB ↗ |