DPCfam | MC19088
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 373 ± 44 aa |
| Residues in low-complexity regions (%) | 14.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.5 |
| Average transmembrane regions | 1.05 |
| Dominant Pfam architecture(s) | PF07163 |
| Sequences matching dominant architecture (%) | 4.29 |
| Average overlap percent | 36.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A163K5P7 | 3-321 | 319 | DIQGQYNRAFRYFLLTKNEQAATTCVKALNKLSALPQHPPIDSLSAMQLQLQLLYINIASMTLSTTTTPTPQLAKRFGLSTCPLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H719-F1 | 27-446 | 100.00 | 75.34 | View in AlphaFoldDB ↗ |