DPCfam | MC190800
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 77 ± 13 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.63 |
| Average transmembrane regions | 0.16 |
| Dominant Pfam architecture(s) | PF04084 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 28.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6BMC7 | 451-538 | 88 | LIRSKEKNKLNDLHKSLYHQWCFELTCGFSLNFYGVGSKIKLIGDFVQNYLVDWYEQNMQEDEEYPDILVVNGYNPAVKFKKVAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q60862-F1 | 282-355 | 97.33 | 92.24 | View in AlphaFoldDB ↗ |