DPCfam | MC190761
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 197 ± 20 aa |
| Residues in low-complexity regions (%) | 5.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09829 |
| Sequences matching dominant architecture (%) | 98.24 |
| Average overlap percent | 89.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000735C87E | 10-199 | 190 | AFSLLATGVFASELKLSRDIELLMLNGIAADSLNQQYQLGKDSNQIVVRYDRVFDTGSRSQRFESKPFVITFANNGKDITINPPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q87FU4-F1 | 9-219 | 99.01 | 81.43 | View in AlphaFoldDB ↗ |