DPCfam | MC19064
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Residues in low-complexity regions (%) | 1.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.62 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03178 |
| Sequences matching dominant architecture (%) | 7.17 |
| Average overlap percent | 1.31 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L9SCZ0 | 633-794 | 162 | FPRSVLVTEVLADSPPTLFISMADGSVITFAFQAEEGTEYSLTGMNKLILGSEQPTFKRLPRGGNDNSDSHAGGLSNVFATCENP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M0V3-F1 | 595-731 | 95.80 | 88.58 | View in AlphaFoldDB ↗ |