DPCfam | MC190510
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 264 ± 48 aa |
| Residues in low-complexity regions (%) | 1.47 |
| Residues in coiled-coil regions (%) | 3.17 |
| Predicted disordered residues (%) | 25.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18078 |
| Sequences matching dominant architecture (%) | 59.46 |
| Average overlap percent | 49.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3L2H1 | 271-603 | 333 | LVRRAQRLLDGLDNTDVTFRDMMKEDMAIKFPEIKAKLSKFRDVCSEYKLVFQKGLCKVLPNIRGGGMEEEVLIKMLNSKERSPF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q5E5-F1 | 280-532 | 95.26 | 86.88 | View in AlphaFoldDB ↗ |