DPCfam | MC190501
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 116 ± 27 aa |
| Residues in low-complexity regions (%) | 12.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.18 |
| Average transmembrane regions | 0.25 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F52D10 | 29-172 | 144 | TVGLCSTAALRRKKEFAEGEEKINLPAARFEKEEQGEKWTVGWGGISEVMARVLCWSGRNERLELDEGGVGWRDVEATTATATAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M9A2-F1 | 20-145 | 94.26 | 65.59 | View in AlphaFoldDB ↗ |