DPCfam | MC190227
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Residues in low-complexity regions (%) | 4.51 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 33.45 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16078 |
| Sequences matching dominant architecture (%) | 93.26 |
| Average overlap percent | 32.33 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6EUW2 | 28-150 | 123 | VNNESFMNPSSATYLEDMHRLWKVDPKNVHASWDVYFRGVESGRPVGSAYVSPPSMSVPVTGSKQRFVTATSPASLTSSGESLNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O61199-F1 | 51-169 | 94.39 | 73.66 | View in AlphaFoldDB ↗ |