DPCfam | MC190007
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01474 |
| Sequences matching dominant architecture (%) | 99.39 |
| Average overlap percent | 31.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H1QG68 | 288-372 | 85 | GADRIRDVLPALVEKALAEGAAVGWVTDPMHGNTFTAPSGHKTRGFDVILDEIRGFVEVHRALGTHPGGIHLELTGEDVTECVGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6TUB8-F1 | 396-481 | 100.00 | 96.80 | View in AlphaFoldDB ↗ |