DPCfam | MC189999
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 91 ± 18 aa |
| Residues in low-complexity regions (%) | 3.02 |
| Residues in coiled-coil regions (%) | 1.48 |
| Predicted disordered residues (%) | 24.92 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067M0C7 | 10-99 | 90 | QQNAVAEGIRVSLKEKGIITNDMREGVCDLLSLKIPVESVNSTIHTVARMLGSNVPDLIDRCSVSRIALEGLVAANMQSVWEVHN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6G8R8-F1 | 154-187 | 30.09 | 51.63 | View in AlphaFoldDB ↗ |