DPCfam | MC189636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Residues in low-complexity regions (%) | 1.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14779 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1JYJ2 | 46-120 | 75 | IASKWLTAYNDNLCSLYTLTACICFVDLNGDGDQKLVIADLGNGVQGMKLNIYKGTFILSQLTLIDCPSGVVSFY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B3DFT2-F1 | 15-89 | 98.68 | 92.04 | View in AlphaFoldDB ↗ |