DPCfam | MC189334
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 891 |
|---|---|
| Mean domain length (aa) | 194 ± 30 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03443 |
| Sequences matching dominant architecture (%) | 96.29 |
| Average overlap percent | 86.91 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084RTE0 | 49-245 | 197 | QSVGWATTVTDNGFVSAGSINAEDIVCHRGATPAANSATVAAGDSISIKWDTWPESHVGPIIDYLASCNGDCSTADKSSLEFFKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q4L3-F1 | 27-228 | 99.50 | 97.83 | View in AlphaFoldDB ↗ |