DPCfam | MC189322
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 245 ± 38 aa |
| Residues in low-complexity regions (%) | 6.24 |
| Residues in coiled-coil regions (%) | 0.61 |
| Predicted disordered residues (%) | 8.63 |
| Average transmembrane regions | 4.3 |
| Dominant Pfam architecture(s) | PF00664 |
| Sequences matching dominant architecture (%) | 0.97 |
| Average overlap percent | 5.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166AG13 | 25-295 | 271 | LVPAYASAASLGLLCLTGLYAFATRNRTAKDDTAVPEETDTTLSANGNGYSKRLSLASLHGGKAALAWKALRALCVFSLLGLAIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9P7V2-F1 | 100-272 | 70.92 | 78.30 | View in AlphaFoldDB ↗ |