DPCfam | MC189242
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Residues in low-complexity regions (%) | 0.67 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 23.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07804 |
| Sequences matching dominant architecture (%) | 98.15 |
| Average overlap percent | 22.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4R9C1 | 2-107 | 106 | RCYSCGKEVGNKEGYHTACLRKLFGVDYLPAIDLSLAEVNIKAQQMAGRLSISGVQPKLSVKLNRKRKQLEVVSEGGEYILKPQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44033-F1 | 4-111 | 97.35 | 86.92 | View in AlphaFoldDB ↗ |