DPCfam | MC189179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Residues in low-complexity regions (%) | 1.43 |
| Residues in coiled-coil regions (%) | 0.82 |
| Predicted disordered residues (%) | 28.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01474 |
| Sequences matching dominant architecture (%) | 95.18 |
| Average overlap percent | 28.96 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167CQX1 | 239-353 | 115 | FEWDLSHVRKDSIRNRYQQVVDNISEGLQFMSTVGGDNPAWQSIDLFTSHEALLLEYEQSFTRLLRDPTVKSTNGTTDTNSNSTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GXV4-F1 | 204-305 | 98.84 | 80.34 | View in AlphaFoldDB ↗ |