DPCfam | MC18877
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Residues in low-complexity regions (%) | 0.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.11 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF07744 |
| Sequences matching dominant architecture (%) | 86.44 |
| Average overlap percent | 52.71 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078E8R2 | 623-707 | 85 | LMVMYLACKDGISKSQRGSLFEVVDSYVADKRVGYAEPASGVELYLCPTRGETLDLLTKVISKDQLDEAKTLDSGLLGVVVWRRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7UAL3-F1 | 734-818 | 95.51 | 86.92 | View in AlphaFoldDB ↗ |