DPCfam | MC188748
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 362 ± 67 aa |
| Residues in low-complexity regions (%) | 3.79 |
| Residues in coiled-coil regions (%) | 1.32 |
| Predicted disordered residues (%) | 17.08 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF06920 |
| Sequences matching dominant architecture (%) | 95.65 |
| Average overlap percent | 29.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090L8V8 | 1448-1798 | 351 | ESSIEVKWRNTLRSGVPSTQTKSIVSVKTQNTTQSTDSLNIVSMVNSEQSQLVLAYYLTNEIYLTVLDTIEMMISLVSRDESSST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96N67-F1 | 1329-1752 | 99.73 | 75.27 | View in AlphaFoldDB ↗ |