DPCfam | MC188644
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 538 ± 63 aa |
| Residues in low-complexity regions (%) | 3.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.07 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H1XK03 | 407-966 | 560 | GAGAGVELDQVVTHLDVALDGGRLLFRVLFRYSASAELGPLSAVMDGAGAWIGRWTTGTGGLLPPQGIGLSLDAGPVDGGGFLQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CWK2-F1 | 1623-2200 | 93.54 | 72.92 | View in AlphaFoldDB ↗ |