DPCfam | MC188260
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q560T9 | 207-283 | 77 | YRCNITGATGVKPLPQANTANKCGYPTDTSNCTLGAKQPHYWFQKERNNNFQDTYDPPFYNGAYGFMNGAQTDLFDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CIZ4-F1 | 210-288 | 100.00 | 96.07 | View in AlphaFoldDB ↗ |