DPCfam | MC187770
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 558 ± 91 aa |
| Residues in low-complexity regions (%) | 9.04 |
| Residues in coiled-coil regions (%) | 22.84 |
| Predicted disordered residues (%) | 40.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007EC7AA8 | 17-677 | 661 | GSKNKRKLADPSPENATKPGSPLTVTSQSELPSEECQKLSDNESAEAGVVQPKEEVEVGDFECADWDDPIVCQLEELLLSYLQAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0JFD4-F1 | 9-702 | 99.82 | 60.10 | View in AlphaFoldDB ↗ |