DPCfam | MC187741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 210 ± 25 aa |
| Residues in low-complexity regions (%) | 5.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.36 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF02985 |
| Sequences matching dominant architecture (%) | 4.35 |
| Average overlap percent | 14.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007EDA584 | 23-257 | 235 | IQILADALPKIVPYXLINHREELLPLIMCVIERHPDSSTWDSLTHTLFNLIKRPDEQQRRIIMXACVNLAKNVGEMRTETEMLPQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1K1M8-F1 | 463-672 | 99.06 | 94.14 | View in AlphaFoldDB ↗ |