DPCfam | MC187628
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05378- PF01968 |
| Sequences matching dominant architecture (%) | 95.73 |
| Average overlap percent | 16.79 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182FA74 | 2203-2267 | 65 | PEHELRVGAIARELGFAYVTLSHQAMPMCRLVARGFTACAEAYLTPHVERYLDGFRAGFRDGLRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H9Q7-F1 | 217-304 | 100.00 | 84.89 | View in AlphaFoldDB ↗ |