DPCfam | MC187616
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 82 ± 14 aa |
| Residues in low-complexity regions (%) | 1.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00089 |
| Sequences matching dominant architecture (%) | 70.59 |
| Average overlap percent | 29.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FCCB9E | 290-376 | 87 | ALSQAGYSADSQSRLTAHEGCAVLRLFEDGTFFHDCDAIDGDSGSPLFVPEGDGFVVVGIMSASYPDGDGQNEMAVSAHRFYDAW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32G64-F1 | 180-261 | 96.47 | 95.43 | View in AlphaFoldDB ↗ |