DPCfam | MC187519
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.58 |
| Average transmembrane regions | 0.57 |
| Dominant Pfam architecture(s) | PF08491 |
| Sequences matching dominant architecture (%) | 98.33 |
| Average overlap percent | 37.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5A0R3 | 550-633 | 84 | LGAISTFHWQRKNGSSVINILAMALYSLFAANNEYLSMLKVGCFRYFQLGGACISEPCGMLSGLITNPWMLVYHFFSVAFYAIW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SM02-F1 | 398-471 | 98.67 | 91.83 | View in AlphaFoldDB ↗ |