DPCfam | MC187493
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3271 |
|---|---|
| Mean domain length (aa) | 254 ± 75 aa |
| Residues in low-complexity regions (%) | 14.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.38 |
| Average transmembrane regions | 6.06 |
| Dominant Pfam architecture(s) | PF02683 |
| Sequences matching dominant architecture (%) | 52.07 |
| Average overlap percent | 91.39 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q7E4F3 | 24-238 | 215 | PLLAVVTLFGAGVLTSLTPCIYPMIPITAGLLAGSAGATPSRRRAVGLTLTYVTGLALLYALVGLLAGLSGSLFGTVASNPWVQF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DQ11-F1 | 10-221 | 98.83 | 64.08 | View in AlphaFoldDB ↗ |