DPCfam | MC187405
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Residues in low-complexity regions (%) | 0.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11515 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 86.85 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K2V9W7 | 2653-2741 | 89 | SSQASDSYKHRNDFTSNDEYAQYVRDIIQVGMMVRCRRTYEEVYEGDIGRVIILDRHVLHDLNVQVDWQRKGGTYWVRYIHIEII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IWT3-F1 | 360-443 | 96.55 | 77.19 | View in AlphaFoldDB ↗ |