DPCfam | MC1874
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 165 ± 18 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10341 |
| Sequences matching dominant architecture (%) | 47.69 |
| Average overlap percent | 53.61 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I2FN00 | 1-168 | 168 | MSESLKSWLFSHCSTSACTALSGNFDVCDLPFLPGNRIQLLRFLTFLPSRSRSLSSSYSSSSSTLSDIWALVGDRTHCIAARFDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O14246-F1 | 1-134 | 88.37 | 88.02 | View in AlphaFoldDB ↗ |