DPCfam | MC187130
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 210 ± 26 aa |
| Residues in low-complexity regions (%) | 10.8 |
| Residues in coiled-coil regions (%) | 1.98 |
| Predicted disordered residues (%) | 37.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00381- PF05524 |
| Sequences matching dominant architecture (%) | 84.52 |
| Average overlap percent | 85.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U2P233 | 112-332 | 221 | GLSVEQVMAEAHQALTAKYAQLGQSEALPTMSLPEGATDTHNDSKSFSWTVTNPTGIHARPASAIARCLNQFDAEVQIVNGDRVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44715-F1 | 291-395 | 48.99 | 83.73 | View in AlphaFoldDB ↗ |