DPCfam | MC187008
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1301 |
|---|---|
| Mean domain length (aa) | 167 ± 28 aa |
| Residues in low-complexity regions (%) | 3.77 |
| Residues in coiled-coil regions (%) | 0.41 |
| Predicted disordered residues (%) | 20.25 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00118 |
| Sequences matching dominant architecture (%) | 93.41 |
| Average overlap percent | 50.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006AB233F | 28-157 | 130 | KTSKALVAELKKMSKEVEDSELADVAAVSAGNNYEVGADIVKKALSYPLKLIAKNDGSLVSEKVLSSDNPKHGYNAATDKYKDFM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0DA00-F1 | 98-267 | 99.35 | 92.31 | View in AlphaFoldDB ↗ |