DPCfam | MC186883
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 181 ± 43 aa |
| Residues in low-complexity regions (%) | 2.24 |
| Residues in coiled-coil regions (%) | 0.29 |
| Predicted disordered residues (%) | 24.35 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF12234 |
| Sequences matching dominant architecture (%) | 0.82 |
| Average overlap percent | 25.71 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7VDJ1 | 2454-2596 | 143 | DPNCYSWCVMNLGIVQMLQRVLRNTITLTGMEILEFITASPVLYRLLSLLDDWESFFIRKLDTHSTPSLNLFLPTENNQETRYGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q409-F1 | 1309-1459 | 93.17 | 69.53 | View in AlphaFoldDB ↗ |