DPCfam | MC1867
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 599 ± 69 aa |
| Residues in low-complexity regions (%) | 2.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q01R31 | 23-619 | 597 | IEIKERSDVPNSAYEQIVGRAYFSVDPGLRANAGIVDLDKAARNGAGQVEFSSDLYLLRPKSPAAGNGTVLFEVSNRGGKSALGM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FHX1-F1 | 371-453 | 15.87 | 95.84 | View in AlphaFoldDB ↗ |